PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G046900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 317aa    MW: 36124.1 Da    PI: 6.675
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G046900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.56.5e-50131411127
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         l+pGfrF+Ptdee+v++yL++kv+++++ + ++i evd++k+ePw+Lp+k+k    + +ewyf+ ++d+ky+tg+r+nrat +gyWk tgk
  Brast06G046900.1.p  13 LAPGFRFRPTDEEIVSFYLNNKVKDNNFCT-TAIGEVDMNKWEPWELPMKAKMsgpSVHEWYFYYHKDRKYPTGRRTNRATVAGYWKVTGK 102
                         579************************988.78***************64444334666******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                         dke+++ +g l+ +kktLvfy grap+g+kt+Wvmhey 
  Brast06G046900.1.p 103 DKEIFHGHGFLISMKKTLVFYMGRAPNGKKTNWVMHEYG 141
                         ******9*******************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-546169IPR003441NAC domain
PROSITE profilePS5100552.86913169IPR003441NAC domain
PfamPF023652.4E-2415141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGDLMNHRQQ LGLAPGFRFR PTDEEIVSFY LNNKVKDNNF CTTAIGEVDM NKWEPWELPM  60
KAKMSGPSVH EWYFYYHKDR KYPTGRRTNR ATVAGYWKVT GKDKEIFHGH GFLISMKKTL  120
VFYMGRAPNG KKTNWVMHEY GIPSYTTNDT INTSSNLKDE WVVCRIFHKS TKEVVMSSPM  180
EQKNNDEIMM FMPMSIGDDR QGFDTSTMAC TQTVQLPPLM DPTSSMYQMY DNAGPLSLVP  240
LPTNDLYFGN DQASPISFYQ HHMQMSAQID TPAGEGFMVA LTSGTSSMVL QYHNTNTADE  300
ILLVDQIGRD CMRNAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-451017117170NAC domain-containing protein 19
3swm_B8e-451017117170NAC domain-containing protein 19
3swm_C8e-451017117170NAC domain-containing protein 19
3swm_D8e-451017117170NAC domain-containing protein 19
3swp_A8e-451017117170NAC domain-containing protein 19
3swp_B8e-451017117170NAC domain-containing protein 19
3swp_C8e-451017117170NAC domain-containing protein 19
3swp_D8e-451017117170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559932.10.0PREDICTED: NAC domain-containing protein 59-like
SwissprotQ9FLR33e-64NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0Q3RQ420.0A0A0Q3RQ42_BRADI; Uncharacterized protein
STRINGMLOC_56943.22e-70(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.27e-67Arabidopsis NAC domain containing protein 87